PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009590779.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 274aa    MW: 31115.1 Da    PI: 8.2101
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009590779.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-18115169256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  XP_009590779.1 115 RKKLRLTKEQSAVLEENFKEHSTLNPKQKLALAKRLGLRARQVEVWFQNRRARTK 169
                     678899***********************************************98 PP

2HD-ZIP_I/II121.54.2e-39115204191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rl+keq+++LEe+F+e+++L+p++K +la++Lgl++rqv+vWFqnrRARtk+kq+E d+++Lkr++++l+een+rL+kev+eLr +l
  XP_009590779.1 115 RKKLRLTKEQSAVLEENFKEHSTLNPKQKLALAKRLGLRARQVEVWFQNRRARTKLKQTELDCDFLKRCVENLTEENRRLQKEVQELR-AL 204
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046188.7E-23289IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.8E-1790168IPR009057Homeodomain-like
SuperFamilySSF466893.8E-18104172IPR009057Homeodomain-like
PROSITE profilePS5007117.038111171IPR001356Homeobox domain
SMARTSM003895.2E-15113175IPR001356Homeobox domain
PfamPF000464.2E-16115169IPR001356Homeobox domain
CDDcd000867.65E-14115172No hitNo description
PRINTSPR000313.3E-5142151IPR000047Helix-turn-helix motif
PROSITE patternPS000270146169IPR017970Homeobox, conserved site
PRINTSPR000313.3E-5151167IPR000047Helix-turn-helix motif
Gene3DG3DSA:1.20.5.1704.4E-4169203No hitNo description
PfamPF021832.6E-9171205IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.2E-25171214IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MEDLGLSLSL SFPQNRTVTN LIRKTSWTDN SFPSSDRNSE TCRVETKTFL KGIDVNRLPE  60
TADAEEEAGV SSPNSTISSV SGNKRNDREA NCEEHDMERA CSRGISDEED GETCRKKLRL  120
TKEQSAVLEE NFKEHSTLNP KQKLALAKRL GLRARQVEVW FQNRRARTKL KQTELDCDFL  180
KRCVENLTEE NRRLQKEVQE LRALKLSPQF YMQMTPPTTL TMCPSCERVA SGPTSTPVNL  240
RLGPPQQLNL WATTPISQGQ FGQMDSHPTL ARQK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163171RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755185e-60HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590779.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466002e-97HAT1_ARATH; Homeobox-leucine zipper protein HAT1
TrEMBLK4C6R31e-144K4C6R3_SOLLC; Uncharacterized protein
STRINGSolyc06g060830.2.11e-143(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.13e-85homeobox protein 2